
Cagrilintide
Supplied for in vitro receptor binding assays and analytical method development.
$57.00
Maximum 10 vials per order. Adding to the cart does not place an order.
Scientific information: Cagrilintide research and specifications
Technical specifications
Reference values, provided as identifiers. Always verify against the certificate of analysis for the lot you receive.
- Compound name
- Cagrilintide
- CAS number
- 1415456-99-3
- Molecular formula
- C194H312N54O59S2
- Molecular weight
- 4409 g/mol
- Sequence
- KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- Form and amount
- Lyophilized powder, 5 mg per vial
- Strengths supplied
- 5 mg, 10 mg
- Purity
- ≥99% by HPLC — matches the certificate of analysis for the lot supplied
- Storage as supplied
- −20 °C, protect from light, desiccate
Identifiers marked with a dagger† are not carried in our catalog record and are shown from a public substance register, via this compound’s research library entry. Always verify against the certificate of analysis for the lot you receive.
Lot documentation
Before your order ships, we send the certificate of analysis and the safety data sheet for the exact lot you receive.
For in vitro research use only. This material is a laboratory reagent. It is not a drug, food, dietary supplement, or cosmetic and is not for human or veterinary use, including ingestion, injection, or any other administration. No information on this page describes or implies any effect in humans or animals. Sold only to researchers under our Terms of Sale.