Tirzepatide Research, Specifications & Scientific Information

Introduction

Tirzepatide began as a question rather than a molecule. Glucagon-like peptide-1 receptor agonists were established; the other incretin, glucose-dependent insulinotropic polypeptide, had been largely written off in diabetes research. The programme that produced tirzepatide was framed explicitly as a test of whether the metabolic action of GIP adds anything to what a selective GLP-1 receptor agonist already does ^[1].

The answer was built into the chemistry. Tirzepatide is a fatty-acid-modified 39-residue peptide whose backbone, as recorded in the FDA/NCATS substance register, is a GIP sequence rather than a GLP-1 one — a compound that reaches the GLP-1 receptor from the other side of the incretin family. It is the first dual incretin receptor agonist to become the active ingredient of an approved pharmaceutical product, and the compound against which the triple agonists that followed are usually positioned.

This page is a reference record. It sets out what has been published about tirzepatide's structure, its receptor pharmacology, and the preclinical and clinical literature, with every source resolved against PubMed, Crossref or ClinicalTrials.gov at the time the page was built. It describes research. It does not describe use in people or animals, and it carries no guidance of any kind on handling the material.

What Is Tirzepatide?

Tirzepatide is a synthetic, fatty-acid-modified 39-residue peptide developed by Eli Lilly and Company under the code LY3298176 and first described in the peer-reviewed literature in 2018 ^[1].

Functionally it is a dual receptor agonist: one molecule that binds and activates two distinct class B1 G protein-coupled receptors — the glucose-dependent insulinotropic polypeptide receptor and the glucagon-like peptide-1 receptor. The informal name the field gave it, "twincretin", names exactly that.

Its regulatory position needs stating with the same care as its pharmacology. Tirzepatide is the active ingredient of finished pharmaceutical products that hold U.S. Food and Drug Administration approval. That approval is granted to a specific finished product — a defined formulation, manufactured under a defined process, labelled for a defined indication. It is not granted to a chemical in the abstract, and nothing about it extends to research-grade material supplied for laboratory use.

Development names persist in the literature and in supplier listings, so the same material is referred to as tirzepatide and as LY3298176.

Tirzepatide Specifications

The 39-residue string above is the backbone recorded for tirzepatide in the FDA/NCATS Global Substance Registration System under UNII OYN3CCI6QE, written in single-letter code. It is a GIP-based backbone, not a GLP-1 one, which is the structural fact behind the molecule's receptor profile. The register carries the backbone only and does not express the molecule's non-standard chemistry: the published description is of a fatty-acid-modified peptide, with substitutions at the positions most exposed to dipeptidyl peptidase-4 cleavage and an acyl chain attached to a lysine side chain, and the discovery paper describes it as designed for once-weekly subcutaneous administration. Letters standing at modified positions in the register's string should therefore not be read as the residues actually present. The molecular formula and mass shown here correspond to the complete acylated molecule and agree between PubChem compound identifier 166567236 and the supplier catalog record. Any figure on this page is a reference value: the certificate of analysis supplied with a laboratory order is the record for a given lot.

Values that a public register does not carry are shown as not publicly characterised rather than estimated. Identifiers are reference values; the certificate of analysis supplied with a laboratory order is the record for a given lot.

How Does Tirzepatide Work?

Both of tirzepatide's targets are class B1 G protein-coupled receptors, and both couple through Gs to raise intracellular cyclic AMP. Beyond that shared signalling, they sit in different tissues and were understood very differently before this compound existed.

The GLP-1 receptor arm is the familiar pharmacology: receptors on pancreatic islet cells modulating glucose-dependent insulin secretion, and receptors in the central nervous system participating in the regulation of food intake. The GIP receptor arm is the interesting one. GIP is the other incretin hormone, and in people with type 2 diabetes its insulinotropic action is blunted — which is why, for years, GIP receptor agonism was treated as a dead end rather than a target.

The design premise reported in the discovery paper is that this judgement was premature, and that GIP receptor agonism contributes something that GLP-1 receptor agonism alone does not reach. The way the molecule was built reflects that: the backbone is GIP, not GLP-1, and GLP-1 receptor activity was engineered onto it rather than the other way round ^[1].

Tirzepatide Mechanism of Action

In vitro research

The discovery characterisation used signalling and functional assays in cell lines expressing recombinant incretin receptors and in cells expressing endogenous ones. In those systems the compound activated both GIP and GLP-1 receptor signalling — the basic demonstration that one molecule engages two receptors ^[1].

The molecule carries the structural features this class of peptide has converged on. It is fatty-acid modified, which gives reversible albumin binding and therefore a plasma residence time long enough for a weekly interval; the paper describes it as designed for once-weekly subcutaneous administration and reports a pharmacokinetic profile characterised across a wide range of administered amounts that supports that interval ^[1].

Relative potency at the two receptors is the tunable parameter of any multi-agonist, and it is what distinguishes one dual agonist from another far more than backbone identity does. Analytical characterisation of supplied material is a separate exercise again, relying on liquid chromatography with mass spectrometric detection against a reference standard rather than on any receptor assay.

What Is Tirzepatide Being Researched For?

Registered clinical research on tirzepatide has covered:

• Type 2 diabetes mellitus — the SURPASS programme, including monotherapy against placebo ^[3] and a head-to-head against a selective GLP-1 receptor agonist ^[2].
• Obesity and overweight — the SURMOUNT programme, in participants without diabetes ^[4] and with diabetes ^[5].
• Cardiovascular outcomes — an active-comparator outcome trial in more than thirteen thousand participants with type 2 diabetes and atherosclerotic cardiovascular disease ^[9].
• A respiratory indication in the context of obesity — two linked phase 3 trials, described by name in the human-research section below ^[7].
• Metabolic dysfunction-associated steatohepatitis — a phase 2 trial with liver biopsy endpoints ^[6].

Each of those is research into a pharmaceutical product, conducted by its sponsor under a registered protocol. None of it is research into, or evidence about, research-grade material supplied for laboratory use.

Human Research on Tirzepatide

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

SURPASS-1 — phase 3 monotherapy in type 2 diabetes

Population. 478 adults with type 2 diabetes inadequately controlled by diet and exercise alone and naive to injectable diabetes therapy, at 52 centres in India, Japan, Mexico and the United States. Mean baseline HbA1c 7.9%, mean age 54.1 years, mean diabetes duration 4.7 years, mean body-mass index 31.9 kg/m² ^{[3, 10]}.

Endpoint and duration. Primary endpoint the mean change in glycated haemoglobin from baseline at 40 weeks, against placebo ^[3].

Result. Mean HbA1c fell by 1.87% (5 mg), 1.89% (10 mg) and 2.07% (15 mg) against +0.04% for placebo, giving treatment differences of −1.91%, −1.93% and −2.11%, all p < 0.0001. Between 87% and 92% of tirzepatide participants reached an HbA1c below 7.0% against 20% on placebo. Body-mass reduction ranged from 7.0 to 9.5 kg across the groups ^[3].

Adverse events. Mild-to-moderate, transient gastrointestinal events: nausea 12–18% against 6%, diarrhoea 12–14% against 8%, vomiting 2–6% against 2%. No clinically significant or severe hypoglycaemia with tirzepatide. One death occurred, in the placebo group ^[3].

Limitations. Forty weeks, 478 participants, monotherapy in early disease against placebo rather than an active comparator.

SURPASS-2 — head-to-head against semaglutide in type 2 diabetes

Population. 1,879 participants with type 2 diabetes on metformin, randomised 1:1:1:1. Mean baseline HbA1c 8.28%, mean age 56.6 years, mean body mass 93.7 kg ^{[2, 11]}.

Endpoint and duration. Primary endpoint the change in glycated haemoglobin from baseline to 40 weeks. Open-label, with semaglutide 1 mg once weekly as the active comparator ^[2].

Result. Estimated mean HbA1c change was −2.01, −2.24 and −2.30 percentage points with tirzepatide 5, 10 and 15 mg against −1.86 with semaglutide; differences against semaglutide were −0.15 (95% CI −0.28 to −0.03; P = 0.02), −0.39 (95% CI −0.51 to −0.26; P < 0.001) and −0.45 percentage points (95% CI −0.57 to −0.32; P < 0.001). Estimated treatment differences in body mass were −1.9 kg, −3.6 kg and −5.5 kg, P < 0.001 for all ^[2].

Adverse events. Predominantly gastrointestinal and mild to moderate in both arms: nausea 17–22% with tirzepatide against 18% with semaglutide; diarrhoea 13–16% against 12%; vomiting 6–10% against 8%. Serious adverse events were reported in 5–7% against 3% ^[2].

Limitations. Open-label, which matters for tolerability reporting; the comparator was used at 1 mg rather than at the higher amount approved later for a different indication; 40 weeks.

SURMOUNT-1 — phase 3 in obesity

Population. 2,539 adults with a body-mass index of 30 or more, or 27 or more with at least one weight-related complication, excluding diabetes. Mean baseline body mass 104.8 kg, mean body-mass index 38.0 ^{[4, 13]}.

Endpoint and duration. Coprimary endpoints the percentage change in body mass from baseline and a reduction of 5% or more, over 72 weeks including a 20-week escalation period ^[4].

Result. Mean percentage change in body mass at week 72 was −15.0% (5 mg), −19.5% (10 mg) and −20.9% (15 mg) against −3.1% for placebo, P < 0.001 for all. Reductions of 5% or more occurred in 85%, 89% and 91% against 35%; reductions of 20% or more in 50% and 57% of the 10 mg and 15 mg groups against 3% ^[4].

Adverse events. Predominantly gastrointestinal, mostly mild to moderate, occurring primarily during escalation. Adverse events caused discontinuation in 4.3%, 7.1% and 6.2% against 2.6% for placebo ^[4].

Limitations. Seventy-two weeks, against anthropometric coprimary endpoints rather than clinical outcomes, in a population from which diabetes was excluded.

SURMOUNT-OSA — two phase 3 trials in obstructive sleep apnoea

Population. Adults with moderate-to-severe obstructive sleep apnoea and obesity, split into two trials: participants not receiving positive airway pressure at baseline (trial 1) and those receiving it (trial 2). Mean baseline apnoea-hypopnoea index 51.5 and 49.5 events per hour; mean body-mass index 39.1 and 38.7 ^{[7, 16]}.

Endpoint and duration. Primary endpoint the change in the apnoea-hypopnoea index from baseline at 52 weeks. Key multiplicity-controlled secondary endpoints included percent change in that index and in body mass, hypoxic burden, patient-reported sleep impairment and disturbance, high-sensitivity C-reactive protein, and systolic blood pressure ^[7].

Result. In trial 1, mean change in the apnoea-hypopnoea index at week 52 was −25.3 events per hour against −5.3 with placebo, an estimated treatment difference of −20.0 events per hour (95% CI −25.8 to −14.2, P < 0.001). In trial 2 it was −29.3 against −5.5, a difference of −23.8 events per hour (95% CI −29.6 to −17.9, P < 0.001). Significant improvements were reported for all prespecified key secondary endpoints ^[7].

Adverse events. Most frequently gastrointestinal, mostly mild to moderate ^[7].

Limitations. Fifty-two weeks; the apnoea-hypopnoea index is a physiological measure, not a clinical outcome; the two trials are small relative to the cardiovascular programme and the population is defined by obesity as well as by the respiratory diagnosis.

SURPASS-CVOT — cardiovascular outcomes against an active comparator

Population. 13,299 participants with type 2 diabetes and atherosclerotic cardiovascular disease randomised 1:1; 134 were subsequently excluded, leaving 6,586 and 6,579 in the modified intention-to-treat population. Mean age 64.1 ± 8.8 years, 29.0% women, mean body-mass index 32.6 ± 5.5, mean glycated haemoglobin 8.4 ± 0.9%, mean diabetes duration 14.7 ± 8.8 years ^{[9, 14]}.

Endpoint and duration. Primary endpoint a composite of death from cardiovascular causes, myocardial infarction or stroke, tested for noninferiority against dulaglutide 1.5 mg with a margin of 1.05 for the upper limit of the 95.3% confidence interval ^[9].

Result. A primary endpoint event occurred in 801 participants (12.2%) on tirzepatide and 862 (13.1%) on dulaglutide — hazard ratio 0.92, 95.3% CI 0.83 to 1.01, P = 0.003 for noninferiority, P = 0.09 for superiority. Noninferiority was met; superiority was not ^[9].

Adverse events. Overall incidence appeared similar between groups, with more gastrointestinal adverse events on tirzepatide ^[9].

Limitations. An active-comparator trial against an agent already shown to reduce cardiovascular events, so it establishes a relationship between two treatments rather than a placebo-referenced effect; the superiority test did not reach significance.

SYNERGY-NASH — phase 2 with liver biopsy endpoints

Population. 190 participants with biopsy-confirmed metabolic dysfunction-associated steatohepatitis and stage F2 or F3 fibrosis; 157 had evaluable week-52 biopsies ^{[6, 12]}.

Endpoint and duration. Primary endpoint resolution of steatohepatitis without worsening of fibrosis at 52 weeks; key secondary endpoint improvement of at least one fibrosis stage without worsening of steatohepatitis ^[6].

Result. Resolution without worsening of fibrosis occurred in 10% of the placebo group against 44% (5 mg), 56% (10 mg) and 62% (15 mg), differences against placebo of 34, 46 and 53 percentage points, P < 0.001 for all three. Improvement of at least one fibrosis stage without worsening occurred in 30% of the placebo group against 55%, 51% and 51% ^[6].

Adverse events. Most commonly gastrointestinal, mostly mild or moderate ^[6].

Limitations. The authors state it plainly: a phase 2 trial in 190 participants, with 33 missing week-52 biopsies imputed to the placebo pattern, and larger and longer trials needed. The fibrosis comparison did not separate the three amounts administered.

Preclinical Research on Tirzepatide

Animal research

The mouse work reported alongside the discovery of the compound is what carried the design premise from a receptor assay into a whole animal.

In mice, the compound produced glucose-dependent insulin secretion and improved glucose tolerance, and the authors attribute those effects to action at both receptors rather than at either alone ^[1].

Under chronic administration in mice, the compound reduced body mass and food intake, and the paper's central preclinical claim is comparative: those effects were significantly greater than the effects of a GLP-1 receptor agonist studied in the same system ^[1]. That comparison is the whole argument for dual agonism, and it was made in rodents before any clinical trial existed.

Findings described in this section were observed in animals. Rodent models of metabolic disease are standard preclinical tools and a poor predictor of human results in this field specifically; nothing in them establishes anything about humans.

Other Areas of Tirzepatide Research

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

The second head-to-head. SURMOUNT-5 repeated the SURPASS-2 comparison in a different population: 751 adults with obesity but without type 2 diabetes, randomised 1:1 to the maximum tolerated amount of tirzepatide (10 mg or 15 mg) or of semaglutide (1.7 mg or 2.4 mg) once weekly for 72 weeks, open-label. Least-squares mean percentage change in body mass at week 72 was −20.2% (95% CI −21.4 to −19.1) against −13.7% (95% CI −14.9 to −12.6), P < 0.001; least-squares mean change in waist circumference was −18.4 cm against −13.0 cm, P < 0.001 ^{[8, 17]}. The trial was open-label and sponsored by the manufacturer of one of the two compounds, both of which are material to how the result is read.

Overlapping populations. SURMOUNT-2 examined the same regimen in participants who had both obesity or overweight and type 2 diabetes, a population excluded from SURMOUNT-1 ^{[5, 15]}. The pattern across the two programmes matches what is seen with other incretin compounds: the anthropometric change is smaller in the population with diabetes.

Two constraints bound all of this. First, every result above belongs to a pharmaceutical product studied under a protocol, in a defined population, under clinical supervision. Second, the endpoints across these trials — a glycated haemoglobin percentage, a percentage of body mass, an events-per-hour index, a histological score, a composite cardiovascular event — are not comparable with one another, and nothing here should be read as if they were.

Current Research Status

Status as of September 22, 2026. This block is rendered from maintained fields, not from prose, so it cannot go stale in one place and stay current in another.

Tirzepatide vs Related Compounds

The distinction between tirzepatide and the compounds it is usually set beside is receptor count and backbone identity, and nothing else stated here.

Receptor agonism

Semaglutide — GLP-1R only. Tirzepatide — GIPR and GLP-1R. Retatrutide — GIPR, GLP-1R and GCGR.

Backbone

Tirzepatide and retatrutide are both built on GIP-family backbones; semaglutide is an analogue of GLP-1 itself. That is a structural difference, not a claim about anything either compound does ^[1].

A different mechanism entirely

Cagrilintide is not an incretin analogue. It is a long-acting amylin analogue acting through the calcitonin and amylin receptor families, and has been studied both alone and co-administered with semaglutide.

Regulatory position

Tirzepatide and semaglutide are active ingredients of approved pharmaceutical products in the United States. Retatrutide and cagrilintide are investigational. Approval is specific to a finished product and an indication and does not extend across a pharmacological class.

Head-to-head trials between tirzepatide and semaglutide exist and are described above with their populations, endpoints and limitations. No comparison of effect between these compounds is made on this page in its own voice; the results belong to the papers that report them.

Chemical & Molecular Characteristics

Tirzepatide is a modified 39-residue peptide. The backbone recorded in the FDA/NCATS Global Substance Registration System under UNII OYN3CCI6QE is YAEGTFTSDYSIGLDKIAQKAFVQWLIAGGPSSGAPPPS.

Three points qualify that string.

It is a GIP backbone. The sequence above is recognisably a glucose-dependent insulinotropic polypeptide sequence, not a GLP-1 one. That is consistent with the published account of the molecule's design, in which GLP-1 receptor activity was engineered onto a GIP scaffold rather than the reverse ^[1].

Single-letter code cannot express the modifications. The published description is of a fatty-acid-modified peptide with the substitutions this family uses to resist dipeptidyl peptidase-4 cleavage ^[1]. Several of those substitutions have no single-letter representation, so letters standing at those positions in the register's string are placeholders in the register's notation rather than the residues actually present. Reading the string as though every letter were a standard amino acid would be a mistake.

The identifiers agree across registers. PubChem compound identifier 166567236 carries the molecular formula C225H348N48O68 and a mass of approximately 4,813 g/mol, matching the value carried in the supplier catalog for the material offered as a laboratory reagent. CAS registry number 2023788-19-2 validates against the CAS check-digit algorithm. PubChem returns several identifiers for the name tirzepatide, corresponding to salts and related records; the one cited here is the entry whose formula and mass correspond to the free acylated peptide.

Analytical Specifications

Analytical figures are lot-specific. Fields the catalog does not carry for the current lot are omitted rather than filled with a typical value. The certificate of analysis and the safety data sheet for the exact lot supplied are provided with a laboratory order; no purity figure on this page is a substitute for that document.

Frequently Asked Questions

Scientific References

1. Coskun T, Sloop KW, Loghin C, et al.. LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus: From discovery to clinical proof of concept Molecular metabolism; 2018. PMID 30473097 doi:10.1016/j.molmet.2018.09.009
2. Frías JP, Davies MJ, Rosenstock J, et al.. Tirzepatide versus Semaglutide Once Weekly in Patients with Type 2 Diabetes The New England journal of medicine; 2021. PMID 34170647 doi:10.1056/NEJMoa2107519
3. Rosenstock J, Wysham C, Frías JP, et al.. Efficacy and safety of a novel dual GIP and GLP-1 receptor agonist tirzepatide in patients with type 2 diabetes (SURPASS-1): a double-blind, randomised, phase 3 trial Lancet (London, England); 2021. PMID 34186022 doi:10.1016/S0140-6736(21)01324-6
4. Jastreboff AM, Aronne LJ, Ahmad NN, et al.. Tirzepatide Once Weekly for the Treatment of Obesity The New England journal of medicine; 2022. PMID 35658024 doi:10.1056/NEJMoa2206038
5. Garvey WT, Frias JP, Jastreboff AM, et al.. Tirzepatide once weekly for the treatment of obesity in people with type 2 diabetes (SURMOUNT-2): a double-blind, randomised, multicentre, placebo-controlled, phase 3 trial Lancet (London, England); 2023. PMID 37385275 doi:10.1016/S0140-6736(23)01200-X
6. Loomba R, Hartman ML, Lawitz EJ, et al.. Tirzepatide for Metabolic Dysfunction-Associated Steatohepatitis with Liver Fibrosis The New England journal of medicine; 2024. PMID 38856224 doi:10.1056/NEJMoa2401943
7. Malhotra A, Grunstein RR, Fietze I, et al.. Tirzepatide for the Treatment of Obstructive Sleep Apnea and Obesity The New England journal of medicine; 2024. PMID 38912654 doi:10.1056/NEJMoa2404881
8. Aronne LJ, Horn DB, le Roux CW, et al.. Tirzepatide as Compared with Semaglutide for the Treatment of Obesity The New England journal of medicine; 2025. PMID 40353578 doi:10.1056/NEJMoa2416394
9. Nicholls SJ, Pavo I, Bhatt DL, et al.. Cardiovascular Outcomes with Tirzepatide versus Dulaglutide in Type 2 Diabetes The New England journal of medicine; 2025. PMID 41406444 doi:10.1056/NEJMoa2505928
10. A Study of Tirzepatide (LY3298176) in Participants With Type 2 Diabetes Not Controlled With Diet and Exercise Alone 2019. NCT03954834
11. A Study of Tirzepatide (LY3298176) Versus Semaglutide Once Weekly as Add-on Therapy to Metformin in Participants With Type 2 Diabetes 2019. NCT03987919
12. A Study of Tirzepatide (LY3298176) in Participants With Nonalcoholic Steatohepatitis (NASH) 2019. NCT04166773
13. A Study of Tirzepatide (LY3298176) in Participants With Obesity or Overweight 2019. NCT04184622
14. A Study of Tirzepatide (LY3298176) Compared With Dulaglutide on Major Cardiovascular Events in Participants With Type 2 Diabetes 2020. NCT04255433
15. A Study of Tirzepatide (LY3298176) in Participants With Type 2 Diabetes Who Have Obesity or Are Overweight 2021. NCT04657003
16. Obstructive Sleep Apnea Master Protocol GPIF: A Study of Tirzepatide (LY3298176) in Participants With Obstructive Sleep Apnea 2022. NCT05412004
17. A Study of Tirzepatide (LY3298176) in Participants With Obesity or Overweight With Weight Related Comorbidities 2023. NCT05822830

Every identifier above is resolved against PubMed, Crossref or ClinicalTrials.gov at build time, and the title returned by the register is compared with the title stored here. A page does not publish if a reference fails to resolve.

Research-Use Information

For in vitro research use only. This material is a laboratory reagent. It is not a drug, food, dietary supplement, or cosmetic and is not for human or veterinary use, including ingestion, injection, or any other administration. No information on this page describes or implies any effect in humans or animals. Sold only to researchers under our Terms of Sale.

Related laboratory reagent: Tirzepatide specifications and lot documentation