Exenatide Research, Specifications & Scientific Information

Exenatide is the synthetic form of exendin-4, a 39-residue peptide isolated from Gila monster venom that acts as an agonist at a single receptor, GLP-1R. It is the active ingredient of approved pharmaceutical products, and that approval belongs to those finished products rather than to the chemical.

Category: GLP-1 and metabolic receptor agonists

Introduction

Exenatide did not come out of a medicinal chemistry programme. It came out of a lizard.

In 1992, a search of Heloderma suspectum venom for a peptide resembling exendin-3 — which had been found the previous year in a related species — produced a 39-residue peptide the authors named exendin-4 [1]. It turned out to activate the glucagon-like peptide-1 receptor, to share roughly half its sequence with human GLP-1, and, crucially, to survive in plasma for hours where the human hormone survives for minutes. No modification was required to achieve that. The molecule arrived already solved.

Exenatide is the synthetic form of that peptide, and it was the first GLP-1 receptor agonist approved anywhere. Everything else in this category — the acylations, the linkers, the Fc fusions — is the pharmaceutical industry reverse-engineering, on a human peptide, a property this one simply had.

This page is a reference record. It sets out what has been published about exenatide's structure, its receptor pharmacology, and the preclinical and clinical literature, with every source resolved against PubMed, Crossref or ClinicalTrials.gov at the time the page was built. It describes research. It does not describe use in people or animals, and it carries no guidance of any kind on handling the material.

What Is Exenatide?

Exenatide is a synthetic 39-residue peptide identical to exendin-4, a natural constituent of Gila monster venom [1].

Its regulatory position needs stating in two parts.

It is an approved active ingredient. Exenatide is the active ingredient of finished pharmaceutical products that have held U.S. Food and Drug Administration approval for type 2 diabetes: a twice-daily solution and an extended-release once-weekly formulation. Whether any individual product remains commercially marketed is a decision of its sponsor and is a separate question from whether it was approved.

The approval belongs to those finished products. Regulatory approval in the United States is granted to a specific finished product — a defined formulation, manufactured under a defined process, labelled for a defined indication — and not to a chemical in the abstract. Nothing about that approval extends to research-grade material supplied for laboratory use.

Structurally, exenatide sits in the glucagon–secretin peptide superfamily but in a different branch from the human hormone: it is an exendin, not a GLP-1 analogue. Functionally it is a single-receptor agonist at GLP-1R.

Exenatide Specifications

Compound name
Exenatide
Full chemical name
Not publicly characterised
Aliases
Exendin-4, AC2993, Byetta, Bydureon, synthetic exendin-4
Development code
AC2993
CAS number
141758-74-9
PubChem CID
45588096
UNII
9P1872D4OL
Compound type
Synthetic peptide identical to a naturally occurring lizard venom peptide
Peptide family
Glucagon / secretin peptide superfamily (GLP-1 receptor ligands); exendin subfamily
Amino acid sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Sequence length
39 residues
Molecular formula
C184H282N50O60S
Molecular weight
4186.6 g/mol
Primary target
Glucagon-like peptide-1 receptor (GLP-1R)
Secondary targets
Not publicly characterised
Receptor family
Class B1 (secretin-like) G protein-coupled receptors
Agonist / antagonist status
Agonist at the GLP-1 receptor

Exenatide is the synthetic form of exendin-4, a 39-residue peptide isolated in 1992 from the venom of the Gila monster, Heloderma suspectum. The sequence above is recorded in the FDA/NCATS Global Substance Registration System under UNII 9P1872D4OL and agrees with the sequence reported in the isolation paper. What the single-letter string does not express is the C-terminal amidation, which is present in the natural peptide and reproduced in the synthetic one. There is no acylation, no non-standard residue and no fusion partner: exenatide is unusual in this family for being pharmacologically long-acting without being chemically modified at all. Its resistance to dipeptidyl peptidase-4 comes from the glycine at position 2, a residue the lizard peptide simply has and the human hormone does not. Exenatide is approximately 53% identical to human glucagon-like peptide-1 and is not an analogue of it in the sense that liraglutide or semaglutide are — the two peptides are separate natural products that converge on the same receptor. Registers differ in the last significant figure of the calculated mass: PubChem CID 45588096 carries approximately 4187 and the Global Substance Registration System approximately 4188 for the same formula. Any figure on this page is a reference value: the certificate of analysis supplied with a laboratory order is the record for a given lot.

Values that a public register does not carry are shown as not publicly characterised rather than estimated. Identifiers are reference values; the certificate of analysis supplied with a laboratory order is the record for a given lot.

How Does Exenatide Work?

The GLP-1 receptor is a class B1 G protein-coupled receptor that signals through Gs to raise intracellular cyclic AMP. It is expressed on pancreatic islet cells, where its activation modulates glucose-dependent insulin secretion, and at sites in the central nervous system involved in the regulation of food intake. Exenatide engages that receptor as an agonist.

What distinguishes exenatide from every other compound in this category is that its duration is structural in the plainest sense: it is a property of the sequence the lizard evolved, not of anything added to it. Dipeptidyl peptidase-4 cleaves its substrates after the second residue. Native GLP-1 has alanine there, which the enzyme accepts. Exendin-4 has glycine, which it does not. That single difference is the whole of the mechanism by which exenatide resists the enzyme, and it required no chemistry at all.

Duration beyond that is a formulation question rather than a molecular one. Exenatide's plasma residence supports twice-daily administration; the once-weekly product reaches its schedule by encapsulating the same unmodified peptide in biodegradable microspheres. That is a different strategy from the albumin-binding acylation used by liraglutide and semaglutide and from the immunoglobulin fusion used by dulaglutide, and it has different consequences: the molecule in the bloodstream is the same in both products, and only the release profile differs.

Exenatide Mechanism of Action

In vitro research

The receptor pharmacology was characterised in the isolation paper, before anyone had proposed the peptide as a medicine, and it is unusually clean.

In dispersed acini from guinea pig pancreas, both natural and synthetic exendin-4 stimulated a monophasic rise in cyclic AMP beginning at 100 pM and plateauing at 10 nM. That rise was progressively inhibited by increasing concentrations of exendin-(9-39) amide, the receptor antagonist derived from the same peptide by truncation [1].

Three negative findings in the same experiments did more to define the molecule than the positive one. Unlike exendin-3, exendin-4 did not stimulate a second rise in acinar cyclic AMP above 100 nM, did not stimulate amylase release, and did not inhibit the binding of radiolabelled vasoactive intestinal peptide. Together these established that in this preparation exendin-4 interacts only with the exendin receptor and not with the vasoactive intestinal peptide receptor that exendin-3 also engages [1]. Two peptides differing at two positions, and one of them is selective while the other is not.

Sequence identity with human GLP-1 is approximately 53% [2] — the number worth carrying, because it sets the expectation for how far human GLP-1 structure-activity work transfers to this molecule, which is not very far.

Analytical characterisation of supplied material is a separate exercise from receptor pharmacology and relies on liquid chromatography with mass spectrometric detection against a reference standard rather than on any biological assay.

What Is Exenatide Being Researched For?

Registered clinical research on exenatide has covered, in rough order of how early each programme reported:

  • Type 2 diabetes mellitus — the phase 3 programme for the twice-daily product [3] and the trials that established the once-weekly formulation [4].
  • Cardiovascular outcomes in type 2 diabetes — an event-driven trial in more than fourteen thousand participants [6].
  • Parkinson's disease — an investigator-led phase 2 trial [5] followed by a phase 3 trial that did not confirm it [7].

Every one of those programmes studied pharmaceutical material, manufactured to a regulatory standard, administered under a registered protocol to a defined population under clinical supervision. None of it is research into, or evidence about, research-grade material supplied for laboratory use.

Human Research on Exenatide

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

AMIGO-1 — phase 3 added to metformin

Population. 336 randomised participants with type 2 diabetes not controlled on maximally effective metformin, at 82 United States sites; 272 completed. Baseline mean age 53 ± 10 years, body-mass index 34.2 ± 5.9 kg/m², glycated haemoglobin 8.2 ± 1.1% [3].

Endpoint and duration. Thirty weeks, triple-blind and placebo-controlled, after a four-week placebo lead-in; four weeks at 5 µg twice daily followed by 26 weeks at 5 or 10 µg twice daily, with metformin continued throughout [3].

Result. At week 30, change in glycated haemoglobin was −0.78 ± 0.10% in the 10 µg group, −0.40 ± 0.11% in the 5 µg group and +0.08 ± 0.10% with placebo, adjusted P < 0.002. Among evaluable participants, 46%, 32% and 13% respectively reached glycated haemoglobin of 7% or below, P < 0.01 against placebo. Change in body mass was −2.8 ± 0.5 kg and −1.6 ± 0.4 kg in the two exenatide groups, P < 0.001 against placebo [3].

Adverse events. The most frequent were gastrointestinal, generally mild to moderate. Mild-to-moderate hypoglycaemia was low and similar across arms, with no severe hypoglycaemia [3].

Limitations. Thirty weeks, one background therapy, and an absolute glycated haemoglobin change smaller than those reported for the once-weekly agents that followed — which is the relevant historical context for reading it.

DURATION-1 — once-weekly formulation against twice-daily

Population. 295 participants with type 2 diabetes, baseline glycated haemoglobin 8.3% (SD 1.0), fasting plasma glucose 9 (SD 2) mmol/L, body mass 102 (SD 20) kg, diabetes duration 6.7 (SD 5.0) years, either treatment-naive or on one or more oral agents [4, 8].

Endpoint and duration. Primary endpoint change in glycated haemoglobin at 30 weeks, in a randomised open-label non-inferiority comparison of a long-acting release formulation at 2 mg once weekly against 10 µg twice daily [4].

Result. At 30 weeks, change in glycated haemoglobin was −1.9% (SE 0.1) once weekly against −1.5% (SE 0.1) twice daily, 95% CI for the difference −0.54% to −0.12%, p = 0.0023. A glycated haemoglobin of 7.0% or below was reached by 77% against 61% of evaluable participants, p = 0.0039. Reductions in body mass were similar between the two [4].

Limitations. Open-label, which is hard to avoid when the comparison is between a weekly and a twice-daily administration; the trial was designed for non-inferiority and the superiority result is a secondary reading of it.

EXSCEL — cardiovascular outcomes in type 2 diabetes

Population. 14,752 participants with type 2 diabetes, with or without previous cardiovascular disease; 10,782 (73.1%) had previous cardiovascular disease [6, 9].

Endpoint and duration. Primary composite outcome the first occurrence of death from cardiovascular causes, nonfatal myocardial infarction, or nonfatal stroke. Coprimary hypotheses: noninferiority for safety and superiority for efficacy. Median follow-up 3.2 years, interquartile range 2.2 to 4.4 [6].

Result. A primary composite event occurred in 839 of 7,356 participants (11.4%; 3.7 events per 100 person-years) receiving extended-release exenatide 2 mg weekly and in 905 of 7,396 (12.2%; 4.0 per 100 person-years) receiving placebo — hazard ratio 0.91, 95% CI 0.83 to 1.00. Noninferiority was met, P < 0.001; superiority was not, P = 0.06 [6].

Adverse events. Rates of cardiovascular death, fatal or nonfatal myocardial infarction, fatal or nonfatal stroke, hospitalisation for heart failure and for acute coronary syndrome, and the incidence of acute pancreatitis, pancreatic cancer, medullary thyroid carcinoma and serious adverse events, did not differ significantly between groups [6].

Limitations. The confidence interval's upper bound touches 1.00 and the superiority test did not reach significance. This is a negative efficacy result in a class where several other agents reported positive ones, and it is the reason the class effect is not treated as uniform.

Preclinical Research on Exenatide

Animal research

The comparative animal pharmacology published in 1999 is what made the case that exendin-4 was pharmaceutically distinct from GLP-1 rather than merely similar to it.

In hyperglycaemic db/db and ob/ob mice, reductions in plasma glucose of up to 35% produced by most amounts of native GLP-1 vanished within an hour, while the same amounts of exendin-4 produced a comparable reduction that persisted beyond four hours. On the percentage fall in plasma glucose at one hour, exendin-4 was 5,530-fold more potent than GLP-1 in db/db mice and 5,480-fold more potent in ob/ob mice [2].

The comparison extended across species. In diabetic rhesus monkeys, exendin-4 accelerated glucose lowering by up to 37%, with a half-maximal effective amount of 0.25 µg/kg. In diabetic fatty Zucker rats administered the peptide subcutaneously twice daily for five to six weeks, glycated haemoglobin fell relative to saline-injected controls, and the hyperinsulinaemic euglycaemic clamp showed increases of up to 49% in glucose infusion rate — a direct measure of insulin sensitivity rather than an inference from glucose alone [2].

The isolation work also rested on animal tissue: the cyclic AMP pharmacology described above was measured in acini dispersed from guinea pig pancreas [1].

Findings described in this section were observed in animals. Nothing in them establishes anything about humans, and the potency ratios above are ratios between two peptides in a rodent assay, not statements about either peptide in a person.

Other Areas of Exenatide Research

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

Parkinson's disease, and what happened when the phase 2 result was tested. This is the most instructive sequence in exenatide's record, and it runs in the direction that publication practice usually hides.

The phase 2 trial was single-centre, double-blind and placebo-controlled, enrolling 62 participants aged 25–75 with moderate Parkinson's disease at Hoehn and Yahr stage 2.5 or less on treatment, randomised to exenatide 2 mg or placebo once weekly for 48 weeks with a 12-week washout. At 60 weeks, off-medication scores on part 3 of the MDS-UPDRS had improved by 1.0 point in the exenatide group and worsened by 2.1 points in the placebo group — an adjusted mean difference of −3.5 points, 95% CI −6.7 to −0.3, p = 0.0318. The authors were careful in their own interpretation, writing that whether the compound affected disease pathophysiology or simply produced long-lasting symptomatic effects was uncertain [5, 10].

The phase 3 trial tested it properly: six UK research hospitals, 194 participants randomised, extended-release exenatide 2 mg once weekly against visually identical placebo over 96 weeks, with the same primary outcome measured off dopaminergic medication. At 96 weeks the score had worsened by a mean 5.7 points (SD 11.2) with exenatide and 4.5 points (SD 11.4) with placebo — adjusted coefficient 0.92, 95% CI −1.56 to 3.39, p = 0.47. Serious adverse events occurred in 9 of 97 participants on exenatide and 11 of 97 on placebo. The authors concluded that they found no evidence to support exenatide as a disease-modifying treatment for Parkinson's disease [7, 11].

The pair is worth reading together rather than separately. A 62-participant single-centre trial produced a statistically significant result on a rating scale; a 194-participant multicentre trial over twice the duration did not reproduce it. Nothing about the preclinical neuroprotection literature that motivated both trials changed in between.

Two constraints bound all of this. First, every result above belongs to a pharmaceutical product studied under a protocol. Second, a negative phase 3 result is a result, and it is reported here at the same length as the positive phase 2 that preceded it.

Current Research Status

Regulatory status (United States)
Approved as finished pharmaceutical products. Exenatide is the active ingredient of products that have held U.S. Food and Drug Administration approval — a twice-daily solution and an extended-release once-weekly formulation — developed by Amylin Pharmaceuticals and later marketed by AstraZeneca. That approval attaches to those finished products as manufactured, formulated and labelled by their sponsor. It does not attach to exenatide as a chemical, and it confers nothing on research-grade material supplied for laboratory use. Whether any given product remains commercially marketed is a decision of its sponsor and is separate from the approval itself.
Investigational status
Marketed history in type 2 diabetes. Investigator-led clinical research has continued outside diabetes, most prominently in Parkinson's disease, where a phase 3 trial has reported.
Highest research phase reached
Approved in type 2 diabetes; phase 3 completed and reported in Parkinson's disease, with a negative primary result
Approved uses
The indication of the approved finished products is type 2 diabetes mellitus. These are product indications, not properties of the chemical.
Approval is compound-specific
Yes

Status as of . This block is rendered from maintained fields, not from prose, so it cannot go stale in one place and stay current in another.

Chemical & Molecular Characteristics

Exenatide is a 39-residue peptide. The sequence recorded in the FDA/NCATS Global Substance Registration System under UNII 9P1872D4OL is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS, and it matches the sequence reported in the isolation paper [1].

Three points qualify that string.

It is a natural sequence, not a designed one. Every other GLP-1 receptor agonist in this library carries at least one deliberate change from a natural template. Exenatide carries none: it is the venom peptide, made synthetically. The glycine at position 2 that gives it enzymatic stability, and the C-terminal extension that has no counterpart in human GLP-1, are both features the lizard peptide simply has.

The C-terminal amide is not visible in the string. The natural peptide is amidated at its C-terminus and the synthetic material reproduces that. A free-acid peptide of the same 39 letters is a different compound, and the distinction is one that analytical characterisation is expected to resolve.

The registers agree on formula and differ in rounding. PubChem compound identifier 45588096 and the Global Substance Registration System both carry C184H282N50O60S; the calculated masses they report round to approximately 4187 and 4188 g/mol respectively. CAS registry number 141758-74-9 is carried by both. A second CAS number, 141732-76-5, also appears in the register and refers to a related entry rather than to a different compound — a reminder that a CAS number found in a supplier listing is worth checking against the register rather than trusted.

Frequently Asked Questions

What is exenatide?
Exenatide is the synthetic form of exendin-4, a 39-residue peptide isolated in 1992 from the venom of the Gila monster, Heloderma suspectum [1]. It is an agonist at the glucagon-like peptide-1 receptor and is the active ingredient of pharmaceutical products that have held U.S. Food and Drug Administration approval for type 2 diabetes.
Where does exendin-4 come from, and is it the same as GLP-1?
It is a natural product of lizard venom, not a human hormone and not a designed analogue of one. The isolation paper identified it as a 39-residue peptide differing from the previously described exendin-3 at two positions [1]. It shares approximately 53% sequence identity with human glucagon-like peptide-1 [2] — enough to activate the same receptor, not enough to call it a GLP-1 analogue in the way that liraglutide or semaglutide are.
Why is exenatide long-acting without being chemically modified?
Because of one residue it happens to carry. Dipeptidyl peptidase-4 cleaves after the second residue of native GLP-1; exendin-4 has glycine at position 2, which the enzyme does not accept. In hyperglycaemic mice, reductions in plasma glucose produced by native GLP-1 vanished within an hour while the same amounts of exendin-4 produced comparable reductions that persisted beyond four hours [2]. No acylation, linker or fusion partner is involved.
What receptor does exenatide target?
One receptor: GLP-1R. In dispersed guinea pig pancreatic acini, exendin-4 produced a monophasic rise in cyclic AMP from 100 pM, plateauing at 10 nM and progressively inhibited by the antagonist exendin-(9-39) amide; unlike exendin-3 it did not produce a second rise at higher concentrations and did not displace radiolabelled vasoactive intestinal peptide [1].
Is exenatide FDA approved?
Exenatide is the active ingredient of finished pharmaceutical products that have held U.S. Food and Drug Administration approval for type 2 diabetes — a twice-daily solution and an extended-release once-weekly formulation. Approval in the United States is granted to a specific finished product, as manufactured, formulated and labelled by its sponsor, for a specific indication. It is not granted to a chemical in the abstract, and it does not extend to research-grade material supplied for laboratory use.
What did the cardiovascular outcome trial find?
EXSCEL enrolled 14,752 participants with type 2 diabetes, 73.1% of whom had previous cardiovascular disease, and followed them for a median 3.2 years. A primary composite event occurred in 11.4% of the exenatide group against 12.2% of the placebo group — hazard ratio 0.91, 95% CI 0.83 to 1.00. The trial met its noninferiority hypothesis (P < 0.001) but not its superiority hypothesis (P = 0.06) [6].
What did the Parkinson's disease trials find?
A single-centre phase 2 trial in 62 participants reported an adjusted mean difference of −3.5 points on the MDS-UPDRS part III motor subscale at 60 weeks, favouring exenatide, and the authors explicitly stated that whether this reflected disease modification or a long-lasting symptomatic effect was uncertain [5]. A subsequent phase 3 trial at six UK hospitals randomised 194 participants over 96 weeks and found no difference on the same scale — adjusted coefficient 0.92, 95% CI −1.56 to 3.39, p = 0.47 — concluding that there was no evidence to support exenatide as a disease-modifying treatment [7].
What identifiers are published for exenatide?
CAS registry number 141758-74-9, UNII 9P1872D4OL and PubChem compound identifier 45588096. Both registers carry the formula C184H282N50O60S and differ only in the last significant figure of the calculated mass.

Scientific References

  1. Eng J, Kleinman WA, Singh L, et al.. Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Further evidence for an exendin receptor on dispersed acini from guinea pig pancreas The Journal of biological chemistry; 1992. PMID 1313797
  2. Young AA, Gedulin BR, Bhavsar S, et al.. Glucose-lowering and insulin-sensitizing actions of exendin-4: studies in obese diabetic (ob/ob, db/db) mice, diabetic fatty Zucker rats, and diabetic rhesus monkeys (Macaca mulatta) Diabetes; 1999. PMID 10331407 doi:10.2337/diabetes.48.5.1026
  3. DeFronzo RA, Ratner RE, Han J, et al.. Effects of exenatide (exendin-4) on glycemic control and weight over 30 weeks in metformin-treated patients with type 2 diabetes Diabetes care; 2005. PMID 15855572 doi:10.2337/diacare.28.5.1092
  4. Drucker DJ, Buse JB, Taylor K, et al.. Exenatide once weekly versus twice daily for the treatment of type 2 diabetes: a randomised, open-label, non-inferiority study Lancet (London, England); 2008. PMID 18782641 doi:10.1016/S0140-6736(08)61206-4
  5. Athauda D, Maclagan K, Skene SS, et al.. Exenatide once weekly versus placebo in Parkinson's disease: a randomised, double-blind, placebo-controlled trial Lancet (London, England); 2017. PMID 28781108 doi:10.1016/S0140-6736(17)31585-4
  6. Holman RR, Bethel MA, Mentz RJ, et al.. Effects of Once-Weekly Exenatide on Cardiovascular Outcomes in Type 2 Diabetes The New England journal of medicine; 2017. PMID 28910237 doi:10.1056/NEJMoa1612917
  7. Vijiaratnam N, Girges C, Auld G, et al.. Exenatide once a week versus placebo as a potential disease-modifying treatment for people with Parkinson's disease in the UK: a phase 3, multicentre, double-blind, parallel-group, randomised, placebo-controlled trial Lancet (London, England); 2025. PMID 39919773 doi:10.1016/S0140-6736(24)02808-3
  8. Effects of Exenatide Long-Acting Release on Glucose Control and Safety in Subjects With Type 2 Diabetes Mellitus(DURATION - 1) 2006. NCT00308139
  9. Exenatide Study of Cardiovascular Event Lowering Trial (EXSCEL): A Trial To Evaluate Cardiovascular Outcomes After Treatment With Exenatide Once Weekly In Patients With Type 2 Diabetes Mellitus 2010. NCT01144338
  10. Trial of Exenatide for Parkinson's Disease 2014. NCT01971242
  11. Exenatide Once Weekly Over 2 Years as a Potential Disease Modifying Treatment for Parkinson's Disease 2020. NCT04232969

Every identifier above is resolved against PubMed, Crossref or ClinicalTrials.gov at build time, and the title returned by the register is compared with the title stored here. A page does not publish if a reference fails to resolve.

Research-Use Information