Lixisenatide Research, Specifications & Scientific Information

Lixisenatide is a synthetic 44-residue peptide derived from exendin-4 by deleting one proline and appending six lysine residues, acting as an agonist at a single receptor, GLP-1R. It is the active ingredient of approved pharmaceutical products, and that approval belongs to those finished products rather than to the chemical.

Category: GLP-1 and metabolic receptor agonists

Introduction

Lixisenatide is the second compound in this library built from lizard venom, and the more heavily engineered of the two. Where exenatide is exendin-4 exactly as the Gila monster makes it, lixisenatide is that 39-residue peptide with one proline deleted near the end and six lysine residues hung off an amidated C-terminus. The registers record that construction in the compound's formal chemical name rather than leaving it to be inferred, which is unusual and useful.

The clinical record it carries is more mixed than most in this category, and more interesting for it. Its dedicated cardiovascular outcome trial was neutral. Its most-discussed recent result is not in diabetes at all but in early Parkinson's disease, where a phase 2 trial met its primary endpoint on a motor rating scale — a result that reads very differently when set beside the phase 3 exenatide trial in the same indication that did not.

This page is a reference record. It sets out what has been published about lixisenatide's structure, its receptor pharmacology, and the preclinical and clinical literature, with every source resolved against PubMed, Crossref or ClinicalTrials.gov at the time the page was built. It describes research. It does not describe use in people or animals, and it carries no guidance of any kind on handling the material.

What Is Lixisenatide?

Lixisenatide is a synthetic 44-residue peptide developed by Zealand Pharma under the code AVE0010 and licensed to Sanofi. Structurally it is a derivative of exendin-4, not of human glucagon-like peptide-1, and it is a potent and selective agonist at the GLP-1 receptor [1].

Its regulatory position needs two statements rather than one.

It is an approved active ingredient. Lixisenatide is the active ingredient of finished pharmaceutical products that have held U.S. Food and Drug Administration approval for type 2 diabetes, both as a single-agent product and as a component of a fixed-ratio combination with a basal insulin. Whether any individual product remains commercially marketed is a decision of its sponsor and is a separate question from whether it was approved.

The approval belongs to those finished products. Regulatory approval in the United States is granted to a specific finished product — a defined formulation, manufactured under a defined process, labelled for a defined indication — and not to a chemical in the abstract. Nothing about that approval extends to research-grade material supplied for laboratory use.

Functionally it is a single-receptor agonist at GLP-1R.

Lixisenatide Specifications

Compound name
Lixisenatide
Full chemical name
des-38-proline-exendin-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide
Aliases
AVE0010, ZP10, Adlyxin, Lyxumia
Development code
AVE0010
CAS number
320367-13-3
PubChem CID
90472060
UNII
74O62BB01U
Compound type
Synthetic modified peptide derived from exendin-4
Peptide family
Glucagon / secretin peptide superfamily (GLP-1 receptor ligands); exendin subfamily
Amino acid sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Sequence length
44 residues
Molecular formula
C215H347N61O65S
Molecular weight
4858.5 g/mol
Primary target
Glucagon-like peptide-1 receptor (GLP-1R)
Secondary targets
Not publicly characterised
Receptor family
Class B1 (secretin-like) G protein-coupled receptors
Agonist / antagonist status
Agonist at the GLP-1 receptor

Lixisenatide is a modified exendin-4, not a modified human GLP-1. The 44-residue string above is recorded in the FDA/NCATS Global Substance Registration System under UNII 74O62BB01U and is exendin-4 with the proline at position 38 deleted and six lysine residues appended at the C-terminus, which is amidated. The full chemical name carried by the registers states that construction explicitly. Against native exendin-4, therefore, the molecule is one residue shorter in its original chain and six residues longer overall. The C-terminal amide is not expressible in single-letter code and is part of the compound's identity. The two public registers disagree on the molecular formula for the complete molecule: PubChem CID 90472060 carries C215H347N61O65S and the Global Substance Registration System carries C215H345N60O66S, both at approximately 4858 g/mol. That disagreement is in the nitrogen and oxygen counts and is consistent with the two registers treating the C-terminal amide differently; both are shown here rather than reconciled. Any figure on this page is a reference value: the certificate of analysis supplied with a laboratory order is the record for a given lot.

Values that a public register does not carry are shown as not publicly characterised rather than estimated. Identifiers are reference values; the certificate of analysis supplied with a laboratory order is the record for a given lot.

How Does Lixisenatide Work?

The GLP-1 receptor is a class B1 G protein-coupled receptor that signals through Gs to raise intracellular cyclic AMP. It is expressed on pancreatic islet cells, where its activation modulates glucose-dependent insulin secretion, and at sites in the central nervous system involved in the regulation of food intake. Lixisenatide engages that receptor as an agonist.

What distinguishes lixisenatide within its own family is where its effect falls in time rather than how large it is. Agonists at this receptor slow gastric emptying, and how much they do so depends on how completely the receptor is occupied between administrations: an agonist present continuously produces tachyphylaxis at the vagal circuits that govern gastric emptying, while one whose concentration rises and falls does not. Lixisenatide's published profile is the second kind. Delayed gastric emptying is prominent in its preclinical description [1], and in human monotherapy study its largest effect was on the glucose excursion after a meal rather than on the fasting value [2].

That is the pharmacological reason the compound was developed for once-daily administration and later combined with a basal insulin: the insulin handles the fasting glucose and the peptide handles the meal. The six C-terminal lysines are part of the same design story, altering the molecule's charge and its handling without changing which receptor it binds.

Lixisenatide Mechanism of Action

In vitro research

The cell-based work described in the compound's preclinical profile is about beta-cell survival rather than about receptor occupancy, and it is what the sponsor put forward as the mechanistic case for the compound beyond acute glucose control.

In Ins-1 cells, a rat-derived beta-cell line, lixisenatide protected against apoptosis induced both by lipid exposure and by cytokines. In human islets it prevented lipotoxicity-induced insulin depletion and preserved insulin production, insulin storage and beta-cell function in vitro [1]. The human-islet result is the more load-bearing of the two, for the obvious reason that a rat beta-cell line is a model of a beta cell rather than a beta cell.

The same profile reports that the enhancement of glucose-stimulated insulin secretion occurred in a strictly glucose-dependent manner [1] — the property that separates this receptor's pharmacology from insulin secretagogues that act irrespective of glucose.

Two cautions belong with this section. The source is a review of the preclinical programme rather than a primary report of a single experiment, so the experimental detail behind each claim sits in the studies it summarises. And cytoprotection in cultured cells is a long way from disease modification in a person; nothing in the human record described below tests it.

Analytical characterisation of supplied material is a separate exercise from receptor pharmacology and relies on liquid chromatography with mass spectrometric detection against a reference standard rather than on any biological assay.

What Is Lixisenatide Being Researched For?

Registered clinical research on lixisenatide has covered:

  • Type 2 diabetes mellitus — the GetGoal phase 3 programme, including a monotherapy trial [2].
  • Cardiovascular outcomes after an acute coronary syndrome — an event-driven trial in participants with a recent myocardial infarction or hospitalisation for unstable angina [3].
  • Early Parkinson's disease — an investigator-led phase 2 trial with a motor rating scale as the primary endpoint [4].

Every one of those programmes studied pharmaceutical material, manufactured to a regulatory standard, administered under a registered protocol to a defined population under clinical supervision. None of it is research into, or evidence about, research-grade material supplied for laboratory use.

Human Research on Lixisenatide

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

ELIXA — cardiovascular outcomes after an acute coronary syndrome

Population. 6,068 participants with type 2 diabetes who had had a myocardial infarction or been hospitalised for unstable angina within the previous 180 days, randomised to lixisenatide or placebo in addition to locally determined standards of care [3, 6].

Endpoint and duration. Primary composite endpoint of cardiovascular death, myocardial infarction, stroke, or hospitalisation for unstable angina. The trial was powered for both noninferiority, at an upper 95% confidence bound below 1.3, and superiority, at an upper bound below 1.0. Median follow-up 25 months [3].

Result. A primary endpoint event occurred in 406 participants (13.4%) receiving lixisenatide and 399 (13.2%) receiving placebo — hazard ratio 1.02, 95% CI 0.89 to 1.17. Noninferiority was shown, P < 0.001; superiority was not, P = 0.81. There were no significant between-group differences in hospitalisation for heart failure (hazard ratio 0.96, 95% CI 0.75 to 1.23) or in death (hazard ratio 0.94, 95% CI 0.78 to 1.13) [3].

Adverse events. Lixisenatide was not associated with a higher rate of serious adverse events, severe hypoglycaemia, pancreatitis, pancreatic neoplasms or allergic reactions than placebo [3].

Limitations. A neutral result, and the authors state it plainly: the addition of lixisenatide to usual care did not significantly alter the rate of major cardiovascular events. The population is a narrow one — recent acute coronary syndrome — and the 25-month median follow-up is short for an outcome trial of this kind. This trial is the clearest single piece of evidence against treating cardiovascular benefit as a property of the GLP-1 receptor agonist class rather than of individual products.

GetGoal-Mono — phase 3 monotherapy

Population. 361 participants with type 2 diabetes not receiving glucose-lowering therapy, glycated haemoglobin 7–10%, mean baseline 8.0% [2, 5].

Endpoint and duration. Primary endpoint change in glycated haemoglobin from baseline to week 12, in a randomised double-blind placebo-controlled trial comparing two once-daily escalation regimens against matched placebo groups [2].

Result. Least-squares mean change in glycated haemoglobin against placebo was −0.54% for the two-step regimen and −0.66% for the one-step regimen, P < 0.0001 for both. A glycated haemoglobin below 7.0% was reached by 52.2% and 46.5% against 26.8% on placebo, and 6.5% or below by 31.9% and 25.4% against 12.5%, P < 0.01. Two-hour postprandial glucose and glucose excursion during a standardised breakfast test improved markedly, with the authors reporting a 75% reduction in glucose excursion. Fasting plasma glucose fell significantly in both lixisenatide groups. Mean reductions in body mass of approximately 2 kg were observed in all groups, including placebo [2].

Adverse events. The most common were gastrointestinal; nausea was the most frequent, in 23% of lixisenatide participants overall against 4.1% on placebo. Symptomatic hypoglycaemia occurred in 1.7% against 1.6%, with no severe episodes [2].

Limitations. Twelve weeks — short even by the standards of a monotherapy registration trial — with 361 participants and no active comparator. The change in body mass was similar in the placebo groups, which is worth noting rather than passing over.

Preclinical Research on Lixisenatide

Animal research

The animal work summarised in the compound's preclinical profile extends the cell-based findings described above into whole animals, and adds the pharmacodynamic observations that shaped the clinical programme.

In animal models of type 2 diabetes, lixisenatide improved basal blood glucose and glycated haemoglobin, with what the authors describe as a rapid onset and a sustained duration of action, and prevented the deterioration of pancreatic responsiveness and of glucose homeostasis over time. Enhancement of insulin biosynthesis and increased pancreatic beta-cell volume were also demonstrated in those models. The compound delayed gastric emptying and reduced food intake [1].

Beta-cell volume is the claim in that list that carries the most weight and the least certainty. An increase in beta-cell volume in a rodent model of diabetes has been reported for several agonists at this receptor and has never been demonstrated in a person, for the straightforward reason that measuring it would require pancreatic tissue.

Findings described in this section were observed in animals. Nothing in them establishes anything about humans.

Other Areas of Lixisenatide Research

Human clinical research

Results from pharmaceutical clinical trials describe the investigational material and populations used in those studies and should not be interpreted as establishing the effects of research-grade materials offered for laboratory use.

Early Parkinson's disease. LIXIPARK was a phase 2, double-blind, randomised, placebo-controlled trial motivated by neuroprotective findings for this compound in a mouse model of the disease. It enrolled 156 participants in whom Parkinson's disease had been diagnosed less than three years earlier, who were on stable symptomatic medication and had no motor complications, randomised 1:1 to daily subcutaneous lixisenatide or placebo for 12 months followed by a two-month washout. The primary endpoint was the change from baseline in MDS-UPDRS part III score, assessed in the on-medication state at 12 months [4, 7].

At 12 months, scores had changed by −0.04 points with lixisenatide, indicating slight improvement, and by 3.04 points with placebo, indicating worsening — a difference of 3.08 points, 95% CI 0.86 to 5.30, P = 0.007. At 14 months, after washout, mean motor scores off medication were 17.7 (95% CI 15.7 to 19.7) with lixisenatide and 20.6 (95% CI 18.5 to 22.8) with placebo. Other secondary endpoints did not differ substantially between groups. Nausea occurred in 46% of participants receiving lixisenatide and vomiting in 13% [4].

Three things bound that result. The trial is phase 2 with 156 participants over 12 months, and its authors say directly that longer and larger trials are needed. The primary endpoint was assessed on medication, which is a different measurement from the off-medication assessment used as the primary endpoint in the exenatide trials. And the closest comparison available — the phase 3 exenatide trial in Parkinson's disease — did not find a difference on the same scale, which is the context in which a positive phase 2 in this indication should be read.

Two constraints bound all of this. First, every result above belongs to a pharmaceutical product studied under a protocol. Second, none of these results is about the same endpoint as any other, and nothing here should be read as if they were comparable.

Current Research Status

Regulatory status (United States)
Approved as finished pharmaceutical products. Lixisenatide is the active ingredient of products that have held U.S. Food and Drug Administration approval, developed by Zealand Pharma and licensed to Sanofi, marketed both as a single-agent product and as a component of a fixed-ratio combination with insulin glargine. That approval attaches to those finished products as manufactured, formulated and labelled by their sponsor. It does not attach to lixisenatide as a chemical, and it confers nothing on research-grade material supplied for laboratory use. Whether any given product remains commercially marketed is a decision of its sponsor and is separate from the approval itself.
Investigational status
Marketed history in type 2 diabetes. Investigator-led clinical research has continued outside diabetes, most prominently a phase 2 trial in early Parkinson's disease.
Highest research phase reached
Approved in type 2 diabetes; phase 2 completed and reported in early Parkinson's disease
Approved uses
The indication of the approved finished products is type 2 diabetes mellitus, as a single agent and in a fixed-ratio combination with a basal insulin. These are product indications, not properties of the chemical.
Approval is compound-specific
Yes

Status as of . This block is rendered from maintained fields, not from prose, so it cannot go stale in one place and stay current in another.

Chemical & Molecular Characteristics

Lixisenatide is a 44-residue peptide. The sequence recorded in the FDA/NCATS Global Substance Registration System under UNII 74O62BB01U is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK, and the same registers carry the formal chemical name: des-38-proline-exendin-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide.

Three points qualify that record.

The construction is stated, not inferred. That chemical name is a set of instructions: start from exendin-4, remove the proline at position 38, append five lysines and a lysinamide. Comparing the two sequences confirms it — the first 37 residues are identical to exendin-4's, the proline is gone, and the six lysines follow. It is rare for a modified peptide's identity to be this legible from its register entry, and it is worth using when checking supplier material.

The C-terminal amide is not in the string. The final residue is a lysinamide, and a free-acid peptide of the same 44 letters is a different compound with a different mass. This is exactly the kind of difference that mass spectrometry resolves and that a sequence listing does not.

The registers disagree on the formula. PubChem compound identifier 90472060 carries C215H347N61O65S; the Global Substance Registration System carries C215H345N60O66S. Both give approximately 4858 g/mol. The disagreement is in nitrogen and oxygen counts, consistent with the two registers treating the C-terminal amide differently. Both are shown here rather than reconciled, because choosing one would mean presenting a convention as a settled fact. CAS registry number 320367-13-3 is carried by both.

Frequently Asked Questions

What is lixisenatide?
Lixisenatide is a synthetic 44-residue peptide developed by Zealand Pharma under the code AVE0010 and licensed to Sanofi. It is built from exendin-4 — the lizard venom peptide that is also the basis of exenatide — by deleting the proline at position 38 and appending six lysine residues at an amidated C-terminus. It is a potent and selective agonist at the glucagon-like peptide-1 receptor [1].
How does lixisenatide differ from exenatide?
They share the same origin and the same receptor. The differences are at the C-terminus: lixisenatide removes one proline from the exendin-4 chain and adds a run of six lysines, and the resulting molecule is 44 residues against exendin-4's 39. The registers record that construction explicitly in the compound's full chemical name. No comparison of effect between the two is made on this page.
How does lixisenatide work?
It binds and activates the glucagon-like peptide-1 receptor, a class B1 G protein-coupled receptor. The published preclinical profile describes enhancement of glucose-stimulated insulin secretion occurring in a strictly glucose-dependent manner, together with delayed gastric emptying and reduced food intake [1]. In human monotherapy study the most pronounced effect was on postprandial rather than fasting glucose, with a reported 75% reduction in glucose excursion during a standardised breakfast test [2].
What receptor does lixisenatide target?
One receptor: GLP-1R. That single-receptor profile is shared with exenatide, liraglutide, semaglutide and dulaglutide, and distinguishes all of them from tirzepatide, which is an agonist at two receptors, and from retatrutide, which is an agonist at three [1].
Is lixisenatide FDA approved?
Lixisenatide is the active ingredient of finished pharmaceutical products that have held U.S. Food and Drug Administration approval for type 2 diabetes, as a single agent and as a component of a fixed-ratio combination with a basal insulin. Approval in the United States is granted to a specific finished product, as manufactured, formulated and labelled by its sponsor, for a specific indication. It is not granted to a chemical in the abstract, and it does not extend to research-grade material supplied for laboratory use.
What did the ELIXA cardiovascular outcome trial find?
ELIXA randomised 6,068 participants with type 2 diabetes who had had a myocardial infarction or been hospitalised for unstable angina within the previous 180 days, and followed them for a median 25 months. A primary composite event occurred in 406 participants (13.4%) receiving lixisenatide and 399 (13.2%) receiving placebo — hazard ratio 1.02, 95% CI 0.89 to 1.17. Noninferiority was shown (P < 0.001); superiority was not (P = 0.81). There were no significant between-group differences in hospitalisation for heart failure or in death [3].
What did the Parkinson's disease trial find?
LIXIPARK was a phase 2, double-blind, placebo-controlled trial in 156 participants with Parkinson's disease diagnosed less than three years earlier. At 12 months, MDS-UPDRS part III scores had changed by −0.04 points with lixisenatide and 3.04 points with placebo — a difference of 3.08, 95% CI 0.86 to 5.30, P = 0.007. Other secondary endpoints did not differ substantially. Nausea occurred in 46% of participants receiving lixisenatide and vomiting in 13%. The authors state that longer and larger trials are needed [4].
What identifiers are published for lixisenatide?
CAS registry number 320367-13-3, UNII 74O62BB01U and PubChem compound identifier 90472060. The two registers carry different molecular formulae for the complete molecule — C215H347N61O65S in PubChem against C215H345N60O66S in the Global Substance Registration System — at the same approximate mass, and both are shown on this page rather than reconciled.

Scientific References

  1. Werner U, Haschke G, Herling AW, et al.. Pharmacological profile of lixisenatide: A new GLP-1 receptor agonist for the treatment of type 2 diabetes Regulatory peptides; 2010. PMID 20570597 doi:10.1016/j.regpep.2010.05.008
  2. Fonseca VA, Alvarado-Ruiz R, Raccah D, et al.. Efficacy and safety of the once-daily GLP-1 receptor agonist lixisenatide in monotherapy: a randomized, double-blind, placebo-controlled trial in patients with type 2 diabetes (GetGoal-Mono) Diabetes care; 2012. PMID 22432104
  3. Pfeffer MA, Claggett B, Diaz R, et al.. Lixisenatide in Patients with Type 2 Diabetes and Acute Coronary Syndrome The New England journal of medicine; 2015. PMID 26630143 doi:10.1056/NEJMoa1509225
  4. Meissner WG, Remy P, Giordana C, et al.. Trial of Lixisenatide in Early Parkinson's Disease The New England journal of medicine; 2024. PMID 38598572 doi:10.1056/NEJMoa2312323
  5. GLP-1 Receptor Agonist Lixisenatide in Patients With Type 2 Diabetes for Glycemic Control and Safety Evaluation in Monotherapy 2008. NCT00688701
  6. Evaluation of Cardiovascular Outcomes in Patients With Type 2 Diabetes After Acute Coronary Syndrome During Treatment With AVE0010 (Lixisenatide) 2010. NCT01147250
  7. Study to Evaluate the Effect of Lixisenatide in Patient With Parkinson's Disease 2018. NCT03439943

Every identifier above is resolved against PubMed, Crossref or ClinicalTrials.gov at build time, and the title returned by the register is compared with the title stored here. A page does not publish if a reference fails to resolve.

Research-Use Information